Protein coding transcript 129991

• Transcript: Ll_transcript_216432
• CDS coordinates: 1-405 (+)
• Peptide sequence: RGRGAAGASQRAASNFPRRGGAAQRNTGRVAQGGIVKRRSAPGAPPARSPLYARGDVNSRWQHDMFAGGRQLSSGRGGIVSGGGPTKLLVSNLEYGVSDSDIKELFTEFGPLKSAAVHYDRSGRSLGTADVIFER
• ORF Type: internal

Annotations of Ll_transcript_216432

• Blastp: Aly/REF export factor 2 from Mus with 52.99% of identity
• Blastx: THO complex subunit 4 from Mus with 64.47% of identity
• Eggnog: Polymerase (DNA-directed), delta interacting protein 3(ENOG4111JAW)
• Kegg: Link to kegg annotations (56009)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017425434.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;