Protein coding transcript 129992

• Transcript: Ll_transcript_216417
• CDS coordinates: 142-474 (+)
• Peptide sequence: MEVDEEDVEAPSSSTSSRGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH*
• ORF Type: complete

Annotations of Ll_transcript_216417

• Blastp: RING-box protein 1A from Sophophora with 91.82% of identity
• Blastx: RING-box protein 1A from Sophophora with 91.82% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (Dmel_CG16982)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014491865.1)
• Pfam: Anaphase-promoting complex subunit 11 RING-H2 finger (PF12861.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;