Protein coding transcript 129994

• Transcript: Ll_transcript_216420
• CDS coordinates: 160-717 (+)
• Peptide sequence: MFSKVCKNIINQGARQYSSKKGLKVTVCGGSGGIGQPLSLLLKQSPLITDLAIYDIAPVTPGVVADLSHMDTNSNVTSHVGLDNLKDAVADTDVVIIPAGIPRKPGMTRDDLFNTNISIVCDIIKVIGQVSPHALVGIISNPVNSAVPAAAEILKKLNVYDPKRLFGVTTLDIVRSNRFIAELKCL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_216420

• Blastp: Probable malate dehydrogenase, mitochondrial from Caenorhabditis with 61.02% of identity
• Blastx: Probable malate dehydrogenase, mitochondrial from Caenorhabditis with 61.02% of identity
• Eggnog: Catalyzes the reversible oxidation of malate to oxaloacetate (By similarity)(COG0039)
• Kegg: Link to kegg annotations (CELE_F20H11.3)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453570.1)
• Pfam: lactate/malate dehydrogenase, NAD binding domain (PF00056.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;