Protein coding transcript 129996

• Transcript: Ll_transcript_216426
• CDS coordinates: 1-1089 (+)
• Peptide sequence: LSCLKAPSCVQTISLSFAYRKKKKEMQISKLFSFIFTFQVLVFSFCESQQCNKDNPITTISVSQGGNANFKTIQSAIDSIPAGNSKWIHITVDSGVYKEKVILPNTKPCVFLEGAGKEQTSVQWGDSGTAHHTSTFELQANYTLVKGITFQNNHNIVDEKKNVTPAVATRVHADKCTFIDCGFVGVQDTLFDSFGRHYYYNCYIHGHTDFIFGKGQSIFQDCKIYFGSGIAEPRDGVITANYRSSLDDPSAFVFKNCSIDGSPGIKTNLGRALELGNPRVIISDSYLADVIRPEGWNEVQAFVGSERNITFVEVGCRGPGSNMSGRVSWINKLSDSEINKLLDLSFIDNEGWTSNFPIKIIA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_216426

• Blastp: Probable pectinesterase 66 from Arabidopsis with 46.05% of identity
• Blastx: Probable pectinesterase 66 from Arabidopsis with 46.05% of identity
• Eggnog: pectinesterase(COG4677)
• Kegg: Link to kegg annotations (AT2G47280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418786.1)
• Pfam: Pectinesterase (PF01095.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;