Transcript | Ll_transcript_216423 |
---|---|
CDS coordinates | 3-308 (+) |
Peptide sequence | RLSALGNVIACNDYVALVHPDLDKETEEILSDVLEVEVFRQTVAANVLVGSYCSLSNRGGLVHPRTSIQDQDELSSLLQVPLVAGTINRGSEVIGGGMVVND |
ORF Type | internal |
Blastp | Eukaryotic translation initiation factor 6 from Xenopus with 84.31% of identity |
---|---|
Blastx | Eukaryotic translation initiation factor 6 from Xenopus with 84.31% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (398731) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016176122.1) |
Pfam | eIF-6 family (PF01912.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer