Protein coding transcript 130002

• Transcript: Ll_transcript_216424
• CDS coordinates: 2-331 (+)
• Peptide sequence: VKVQRVEERLSALGNVIACNDYVALVHPDLDKETEEILSDVLEVEVFRQTVAANVLVGSYCSLSNRGGLVHPRTSIQDQDELSSLLQVPLVAGTINRGSEVIGGGMVVND
• ORF Type: internal

Annotations of Ll_transcript_216424

• Blastp: Eukaryotic translation initiation factor 6 from Xenopus with 83.64% of identity
• Blastx: Eukaryotic translation initiation factor 6 from Xenopus with 83.64% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (398731)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004495448.1)
• Pfam: eIF-6 family (PF01912.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;