Protein coding transcript 130006

• Transcript: Ll_transcript_95417
• CDS coordinates: 225-1157 (+)
• Peptide sequence: MTVVNIKDRVKNNKLNLSGLNLTEIPAKEIAPLKVSHLDLSNNKITSTDNVFSLLPSLVKLDLSGNQIKSVAADIGSLQKLAFLSLANNKIKDLPKGLSKLKQLKHLNLNNNPLKPELVEAVGPSQNNAQCQSAAANAIQYLKGDSKKQDDKQNKKKDKKNSKASPNGVQNDKSKNKTKPKKKPAGFVSKVFGFFGMLISYTLLFAVLIGLSLYALSYYDKKAYGNVKAKLLPVWGSVTSNLDPKVASKVNYYLLQAGNSFDQAVHTSIEASIKSYKWVKANPTVQQYAKNVQDTWKSFWDSVFKKVKST*
• ORF Type: complete

Annotations of Ll_transcript_95417

• Blastp: Leucine-rich repeat-containing protein 59 from Danio with 43.66% of identity
• Blastx: Leucine-rich repeat-containing protein 59 from Homo with 46.74% of identity
• Eggnog: Leucine rich repeat containing 59(ENOG4111GH4)
• Kegg: Link to kegg annotations (405868)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003537698.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;