| Transcript | Ll_transcript_357463 |
|---|---|
| CDS coordinates | 31-408 (+) |
| Peptide sequence | MKFVIVAMLVAVCAAQSDKDAPILKLQSDLSPEGGYSWSYETGNGIQAQEQGQVKQAGQDVVQIAQGGFAYTSPDGTPIQVTYTADENGFQPQGAHLPVPPPIPEAILRSLEYNAKNPPHPDYTQ* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Larval cuticle protein LCP-17 from Bombyx with 48.51% of identity |
| Eggnog | Insect cuticle protein(ENOG4110RUZ) |
| Kegg | Link to kegg annotations (692362) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003628802.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer