Protein coding transcript 130016

• Transcript: Ll_transcript_40817
• CDS coordinates: 2-334 (+)
• Peptide sequence: PAYLTIQFVRFFYKEKDKINAKILKDIKFPIEFDAFELCTPELQEKLVPVRSKFKELEDKLAHEGVKPNAKQLAESKEEEKPTAPYWFEDDYGSNNSGYYSLQAVLTHKGR
• ORF Type: internal

Annotations of Ll_transcript_40817

• Blastp: Ubiquitin carboxyl-terminal hydrolase 14 from Oryctolagus with 62.16% of identity
• Blastx: Ubiquitin carboxyl-terminal hydrolase 14 from Oryctolagus with 62.16% of identity
• Eggnog: ubiquitin thiolesterase activity(ENOG410XP96)
• Kegg: Link to kegg annotations (100009078)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016174579.1)
• Pfam: Ubiquitin carboxyl-terminal hydrolase (PF00443.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;