Protein coding transcript 130018

• Transcript: Ll_transcript_13108
• CDS coordinates: 2-304 (+)
• Peptide sequence: DAKDNILVNELKKIIGCIIKVAPANQQLYYKDEIMDETKTLSECGLNSTIAKAQSPATIGLALKMENGEFEPLEMVPYSLPPELPYVMKNQETNGQEPPM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_13108

• Blastp: Elongin-B from Rattus with 48.42% of identity
• Blastx: Elongin-B from Rattus with 48.42% of identity
• Eggnog: Transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)(ENOG4111UGJ)
• Kegg: Link to kegg annotations (81807)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415536.1)
• Pfam: Ubiquitin family (PF00240.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;