Transcript | Ll_transcript_13101 |
---|---|
CDS coordinates | 34-363 (+) |
Peptide sequence | MSPASIASDDGIKVRKILGVQDYIYDKVFRPIAKNDAWTIMPLLLRPRSRGNIRLRSRDPMAYPYIDANYFDDPLDIATLVEGVKLAVKIGQGKAFRQYRSRLHRVPIPG |
ORF Type | 3prime_partial |
Blastp | Glucose dehydrogenase [FAD, quinone] from Sophophora with 45.95% of identity |
---|---|
Blastx | Glucose dehydrogenase [FAD, quinone] from Sophophora with 45.95% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (Dpse_GA11047) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020227260.1) |
Pfam | GMC oxidoreductase (PF05199.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer