Protein coding transcript 130022

• Transcript: Ll_transcript_13090
• CDS coordinates: 141-908 (+)
• Peptide sequence: MASIFSLNMISSLRLSNPSSISTSQIQNQVGSTFFQSFSTKSLNFSTTHQISTSKRSSSNTKTTAFFFNNKPKQHQDSSNPTKVQELSVYEINERDRNSPAYLRLSEKPENSLGDLVPFSNKLYSGDLEKRLGITAGLCVLIQHVPEKKGDRYEATYSFYFGNYGHISVQGPYLTYQDTYLAVTGGSGIFEGVYGQVKLQQIVFPFKLFYTFYLKGIHDLPTELLGKPIEPSPHVEPSLAAKASHPNASLLNFTN*
• ORF Type: complete

Annotations of Ll_transcript_13090

• Blastp: Allene oxide cyclase, chloroplastic from Oryza sativa with 73.96% of identity
• Blastx: Allene oxide cyclase, chloroplastic from Oryza sativa with 73.96% of identity
• Eggnog: allene oxide cyclase(ENOG4111X07)
• Kegg: Link to kegg annotations (4333201)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459371.1)
• Pfam: Allene oxide cyclase (PF06351.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;