Protein coding transcript 130025

• Transcript: Ll_transcript_13099
• CDS coordinates: 1-327 (-)
• Peptide sequence: MNPIVKITVSNHHVTSRPARKNSNTTLFEWNQTFAFSREAPDSSSILEVSVWDPELMNQSLLGGVCFDVNEIPVRDPPDSPLAPQWYRLEDGGAQYGDLMLATWVGTQA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_13099

• Blastp: Protein QUIRKY from Arabidopsis with 51.3% of identity
• Blastx: Protein QUIRKY from Arabidopsis with 51.3% of identity
• Eggnog: Plant phosphoribosyltransferase C-terminal(ENOG410Y912)
• Kegg: Link to kegg annotations (AT1G74720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427611.1)
• Pfam: C2 domain (PF00168.29)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;