Protein coding transcript 130030

• Transcript: Ll_transcript_65923
• CDS coordinates: 1-531 (+)
• Peptide sequence: NQLKMPGPSRPLWQVAGKRDLEQEQEAQHWIESVIQERFPPIPYEMALRDGIILCKLMNRLAPGIISKINTSGGDYKMMDNLSQFHKACVKYGVPDVDLFQTTDLWDQKNIALVTQTIFAIGRTAYRHPEWRGPWLGPRPSEENRRDFSEAQLRASEGIIGLQAGQNKGATQAGQNF
• ORF Type: internal

Annotations of Ll_transcript_65923

• Blastp: Muscle-specific protein 20 from Sophophora with 55.15% of identity
• Blastx: Muscle-specific protein 20 from Sophophora with 55.15% of identity
• Eggnog: Calponin(COG5199)
• Kegg: Link to kegg annotations (Dmel_CG4696)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020959671.1)
• Pfam: Calponin homology (CH) domain (PF00307.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;