Protein coding transcript 130033

• Transcript: Ll_transcript_65949
• CDS coordinates: 1-855 (+)
• Peptide sequence: GFTHSQADQALFTKSSPNSFTLILIYVDDLILAGNNYTEIQHVKHVLDQAYKIKDLGPLRFFLGLEVARSKLGIQLNQRKYTLSLLEDSGGLAAKPLKTPSDPSNKLQLTEGTPLPDPSSYRRLVGRLIYLTITRPDIAHSVQQLSLFMSNPLDSHYKAAIRVLHYLKLSPAQGLFFSSTSTPTLKAFADSDWASCPDSRRSITGFCVFLGSSLISWKTKKQNTVSRSSTEAEYRALGSLVCELQWLQFLLTDLQISSSTPTSVYCDNQSEIYLAHNPVFHERTK
• ORF Type: internal

Annotations of Ll_transcript_65949

• Blastp: Uncharacterized mitochondrial protein AtMg00810 from Arabidopsis with 42.86% of identity
• Blastx: Uncharacterized mitochondrial protein AtMg00810 from Arabidopsis with 42.86% of identity
• Eggnog: Retrotransposon protein(COG2801)
• Kegg: Link to kegg annotations (ArthMp070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442281.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF07727.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;