Protein coding transcript 130037

• Transcript: Ll_transcript_65944
• CDS coordinates: 2-484 (+)
• Peptide sequence: EMIIGGGMAYTFLKESKGMKIGDSLFDEAGAKIVGKLLEKATARNVKIHLPVDFVTADKFDENANTSSATVEEGVPDGWMGLDCGPESRKLFSEPIARAKVIVWNGPAGVFEFDKFAYGTKALMDDVVKATKNGTVTIIGGGDTATCAAKWGTESQISHVS
• ORF Type: internal

Annotations of Ll_transcript_65944

• Blastp: Phosphoglycerate kinase from Sophophora with 71.43% of identity
• Blastx: Phosphoglycerate kinase from Sophophora with 71.43% of identity
• Eggnog: phosphoglycerate kinase(COG0126)
• Kegg: Link to kegg annotations (Dmel_CG3127)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013441343.1)
• Pfam: Phosphoglycerate kinase (PF00162.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;