Protein coding transcript 130039

• Transcript: Ll_transcript_239513
• CDS coordinates: 2-361 (+)
• Peptide sequence: LYCHQMNITSKVKADVQNISGELIVSGLDSATSLIQAAKNLMNAVVLTVKASYVASTKYPRQGPVTLPIVWKMKAPEKKPLVRPEKPEEVRAKVRKGSQKKVQNPIHALSEFQSPTESV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_239513

• Blastp: Catenin alpha from Sophophora with 90.83% of identity
• Blastx: Catenin alpha from Sophophora with 90.83% of identity
• Eggnog: Catenin (Cadherin-associated protein)(ENOG410XSRU)
• Kegg: Link to kegg annotations (Dmel_CG17947)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443774.1)
• Pfam: Vinculin family (PF01044.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;