Protein coding transcript 130040

• Transcript: Ll_transcript_65916
• CDS coordinates: 1-501 (+)
• Peptide sequence: SSSSSTILAPNSSSSSGFLSDILGIRIEEDEEPEEELGAMKEMMYKIAAMQPVDIDPATIRKPKRRNVRISDDPQSVAARHRRERISEKIRILQRLVPGGTKMDTASMLDEAIRYVKFLKRQIRLLQSTPQNPPQQQPQCNVGVASTSALFLASNGCDWPFAPNMSH
• ORF Type: internal

Annotations of Ll_transcript_65916

• Blastp: Transcription factor HEC3 from Arabidopsis with 82.14% of identity
• Blastx: Transcription factor IND from Arabidopsis with 83.15% of identity
• Eggnog: nucleic acid binding transcription factor activity(ENOG410YMAU)
• Kegg: Link to kegg annotations (AT5G09750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436929.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;