Protein coding transcript 130042

• Transcript: Ll_transcript_40946
• CDS coordinates: 2-343 (+)
• Peptide sequence: SEVAKLIGGVWLRVWVQTASALSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRYGTPLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMLMEFIAFVKLRIKYPSVSR
• ORF Type: internal

Annotations of Ll_transcript_40946

• Blastp: Probable polyamine transporter At1g31830 from Arabidopsis with 81.58% of identity
• Blastx: Probable polyamine transporter At1g31830 from Arabidopsis with 81.58% of identity
• Eggnog: amino acid(COG0531)
• Kegg: Link to kegg annotations (AT1G31830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013470355.1)
• Pfam: Amino acid permease (PF13520.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;