Transcript | Ll_transcript_40944 |
---|---|
CDS coordinates | 3-377 (-) |
Peptide sequence | MKLVVEVINAHNLMPKDGEGSASPFVEIDFENQLSRTRTVPKNLNPTWNHKLVFHIDATKPYHRQTIEVSVYNDRKRPIPGRNFLGRVRIPCSNIVKEGDEVYQTFPLENKWFFSSVKGEIGLKI |
ORF Type | 3prime_partial |
Blastp | Protein QUIRKY from Arabidopsis with 45.67% of identity |
---|---|
Blastx | Protein QUIRKY from Arabidopsis with 45.67% of identity |
Eggnog | Plant phosphoribosyltransferase C-terminal(ENOG410Y912) |
Kegg | Link to kegg annotations (AT1G74720) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451242.1) |
Pfam | C2 domain (PF00168.29) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer