Protein coding transcript 130047

• Transcript: Ll_transcript_40930
• CDS coordinates: 3-470 (+)
• Peptide sequence: LLVFSATSKLYEYASSSVQHVIERRDQHSAIHKPNPPSVELQVQSDSNNMLHQKVEYKTRELRQLNGQELHGLTLQELQRLEELLNIGLINVSKLKDDKIMQEISTLRRKEFELMEENQKSKQVLSLMRGQRQSFEFNNIRSSYLPEDDGRDTSLK
• ORF Type: internal

Annotations of Ll_transcript_40930

• Blastp: MADS-box protein JOINTLESS from Lycopersicon with 47.2% of identity
• Blastx: MADS-box protein JOINTLESS from Lycopersicon with 47.2% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006584957.1)
• Pfam: K-box region (PF01486.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;