Protein coding transcript 130050

• Transcript: Ll_transcript_40943
• CDS coordinates: 3-374 (-)
• Peptide sequence: AEVEGHPTLYRPVSRISAFSFYNPPGRQATGSCSKIFPLQGPSIKDVGACKLFSGTGCESMVPLQCGHGCCAVELRGSNSQGSLSGPEFVDYLEPTSFTSHELISLATDLNNIAWNLGSIVALR
• ORF Type: internal

Annotations of Ll_transcript_40943

• Blastp: Transcription factor MYB1 from Arabidopsis with 41.96% of identity
• Blastx: Transcription factor MYB1 from Arabidopsis with 41.96% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT3G09230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454494.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;