| Transcript | Ll_transcript_40936 |
|---|---|
| CDS coordinates | 3-341 (-) |
| Peptide sequence | MTDTSNLLEPLKQLLLLQQPDCIVVDMFHRWAGEVMDDLGIKMIVFTGNGCFPRCVHENIRKHVQLENISSDYEPFIVPNLPDRIEMTKSQLPIFLRDHSVFPDRLKAFKQLE |
| ORF Type | 3prime_partial |
| Blastp | Abscisate beta-glucosyltransferase from Vigna with 59.38% of identity |
|---|---|
| Blastx | Abscisate beta-glucosyltransferase from Vigna with 60.5% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (BAB83692) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019422174.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer