Protein coding transcript 130054

• Transcript: Ll_transcript_98109
• CDS coordinates: 59-355 (+)
• Peptide sequence: MGKDIISSMPNEIIAMILTLLTLKEAVRTSILSRRWKNLWTFFSGFLTFDNSMKTLHMYRDRKTSKRKKCIQFVNEWEKFMSNLERVLRSITSPSLQGL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_98109

• Blastp: F-box/LRR-repeat protein At3g58900 from Arabidopsis with 36.47% of identity
• Blastx: F-box/LRR-repeat protein At3g58900 from Arabidopsis with 36.47% of identity
• Eggnog: F-box domain containing protein, expressed(ENOG410ZC2N)
• Kegg: Link to kegg annotations (AT3G58900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465309.1)
• Pfam: F-box domain (PF00646.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;