| Transcript | Ll_transcript_98104 |
|---|---|
| CDS coordinates | 59-475 (+) |
| Peptide sequence | MLNPSVTCAILVTLTTYMFMVPVQCEENTFPQVTTVSVKNDLGNGIILFLHCKSRDNDLGVHSLAYGQSQTWSFRLNVIGSTLFFCRVTWNNVDRSLEIYNANTDDAQCLSQCYRSVTLDGIFYYWQFKDYWYQKYKW* |
| ORF Type | complete |
| Blastp | S-protein homolog 24 from Arabidopsis with 34.04% of identity |
|---|---|
| Blastx | S-protein homolog 24 from Arabidopsis with 34.04% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_004511060.1) |
| Pfam | Plant self-incompatibility protein S1 (PF05938.10) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer