Protein coding transcript 130066

• Transcript: Ll_transcript_239633
• CDS coordinates: 2-349 (-)
• Peptide sequence: VKPEKLVMGMPLYGMTWQLQDPNVNGIGAPVVRPDPGSNGAMAYFQVVDFNKQRNAKVVYDVDTMSVYSYSGSYWIGYDDPITVTAKVGYAQALTLRGYFFWAAGYDTTNWKISTQ
• ORF Type: internal

Annotations of Ll_transcript_239633

• Blastp: Probable chitinase 10 from Sophophora with 35.45% of identity
• Blastx: Probable chitinase 10 from Sophophora with 35.45% of identity
• Eggnog: chitinase(COG3325)
• Kegg: Link to kegg annotations (Dmel_CG18140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463748.1)
• Pfam: Glycosyl hydrolases family 18 (PF00704.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;