Protein coding transcript 130067

• Transcript: Ll_transcript_239634
• CDS coordinates: 2-715 (-)
• Peptide sequence: MQLLSLALVLTASMNATASATAVKAIYWIDQPLFPASSINTSLFTHVYYAFLAPNATSFKLCVSNSTNITLTNFITTFRSRIPTVTTILSIGGSNATPFSLIFSNITTRATFINSTISVARAYGFDGVDLDWEFPQNSDDTNNLGSLFQEWRIAITADAAITGKPRLVLTAAVYFAVYFSVSDTPWTYPVTSINQNVDWVNVMSYNFHGSWNNDTGAPSGLFNPTRNISVVDGLKSWI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_239634

• Blastp: Chitotriosidase-1 from Homo with 34.63% of identity
• Blastx: Chitotriosidase-1 from Homo with 34.63% of identity
• Eggnog: chitinase(COG3325)
• Kegg: Link to kegg annotations (1118)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463748.1)
• Pfam: Glycosyl hydrolases family 18 (PF00704.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;