Transcript | Ll_transcript_239630 |
---|---|
CDS coordinates | 1-297 (+) |
Peptide sequence | IGKGVMVYNKNEFKRINWCKEDMPMMNSVTKEWFQKVEHLIVDDGENLRASPGMLMGMHNALSTIVGLLATNHRMDKTRMKVLTLRSSDDSMSLYMGNT |
ORF Type | internal |
Blastp | RNA-directed RNA polymerase catalytic subunit from Influenzavirus A with 36.73% of identity |
---|---|
Blastx | RNA-directed RNA polymerase catalytic subunit from Influenzavirus A with 36.73% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020232466.1) |
Pfam | Influenza RNA-dependent RNA polymerase subunit PB1 (PF00602.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer