Protein coding transcript 130068

• Transcript: Ll_transcript_239630
• CDS coordinates: 1-297 (+)
• Peptide sequence: IGKGVMVYNKNEFKRINWCKEDMPMMNSVTKEWFQKVEHLIVDDGENLRASPGMLMGMHNALSTIVGLLATNHRMDKTRMKVLTLRSSDDSMSLYMGNT
• ORF Type: internal

Annotations of Ll_transcript_239630

• Blastp: RNA-directed RNA polymerase catalytic subunit from Influenzavirus A with 36.73% of identity
• Blastx: RNA-directed RNA polymerase catalytic subunit from Influenzavirus A with 36.73% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020232466.1)
• Pfam: Influenza RNA-dependent RNA polymerase subunit PB1 (PF00602.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;