Transcript | Ll_transcript_239645 |
---|---|
CDS coordinates | 1-309 (+) |
Peptide sequence | AYANGLATAATTDAADLLKGWLSGEEVPEGLSIDQGMRWRLVTALARVGRVGEDEIAAELQRDNTISGSEQAAGARAAMPTAQAKQAAWQRATTDDSVPNETY |
ORF Type | internal |
Blastp | Aminopeptidase N from Streptomyces with 49.35% of identity |
---|---|
Blastx | Aminopeptidase N from Streptomyces with 49.35% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | - |
Pfam | ERAP1-like C-terminal domain (PF11838.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer