Protein coding transcript 130082

• Transcript: Ll_transcript_264878
• CDS coordinates: 3-1067 (+)
• Peptide sequence: HFQLTLKENMARVNSASNTPFYSLLLISSLVLASHFNISEAQKGLSLSFFAKTCPQLETIVRNHLKKVFKQDNGQAPGLLRIFFHDCFVQGCDGSVLLDGNPGERDQRANIGLRNEALETIEVLRGLVHKACGKIVSCADITVLAARDAVALSGGPDFAVPLGRKDGVSFSIEKTKDLPGPSGNTNVTLSKFAPKNFDATDVVALSGAHTFGRAHCGTIFGRLSPQDPTMDKTLANNLKATCPSATSTNTVNLDIRTPIVFDNKYYIDLLNRQGVFTSDQDLINHEKTKGLVNSFANDQSLFFKKFANAVVKISQLDVLTGNQGEIRDKCNVVNKKKSILSSVVEEMVEVFDQV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_264878

• Blastp: Peroxidase 12 from Arabidopsis with 54.95% of identity
• Blastx: Peroxidase 12 from Arabidopsis with 54.95% of identity
• Eggnog: peroxidase(ENOG410ZMT4)
• Kegg: Link to kegg annotations (AT1G71695)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453451.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;