Transcript | Ll_transcript_147887 |
---|---|
CDS coordinates | 1-378 (+) |
Peptide sequence | AEIKVEEVSPSIENIGNASISQLPPESNGSSKAARKDNNMSDMEMQDIYEPLTQTTMTQAAPLGNSNSFQTAITDEREQSKTSSPLLPGSRSRQLLPKPPRSTLTAGLEANIGMASQTRVARPPAE |
ORF Type | internal |
Blastp | B3 domain-containing transcription repressor VAL2 from Arabidopsis with 49.15% of identity |
---|---|
Blastx | - |
Eggnog | B3 domain-containing protein(ENOG410Z235) |
Kegg | Link to kegg annotations (AT4G32010) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446941.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer