Protein coding transcript 130091

• Transcript: Ll_transcript_264948
• CDS coordinates: 30-389 (+)
• Peptide sequence: MGVLSLSRIILVLFPIVLLLSFLWSASAANSSNNTFVHCLVNHSNPSHPITSAIFTPKNTSFSSVLQAYIRNLRFNTSTTRKPYLIITALHVSHVQTAIVCAQKHNLQMKIRSGGHDYEG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_264948

• Blastp: Berberine bridge enzyme-like 8 from Arabidopsis with 59.82% of identity
• Blastx: Berberine bridge enzyme-like 8 from Arabidopsis with 61.86% of identity
• Eggnog: FAD linked oxidase domain protein(COG0277)
• Kegg: Link to kegg annotations (AT1G30700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424830.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;