Protein coding transcript 130092

• Transcript: Ll_transcript_264931
• CDS coordinates: 3-677 (+)
• Peptide sequence: KSPALILVGKLIDGYLSEIASDANLKPGKFYNLAISLPDQARLFDDSLYRAVDIYFKAHPRVSEAEREKICGVLDFEKLTLEACTHAAQNERLPLRAVVQVLFYEQIQLRHAIAGTITAATTGEECDTWQVTVRDNQVLRLDMDSMRTRVHQLERECSSMKRVIEKIDEPGPQGGGGGWWASMGLGRKFGCKFKTQVCNSHEPVVVDTRKGRPNHLQHHRSHPE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_264931

• Blastp: BTB/POZ domain-containing protein At5g66560 from Arabidopsis with 62.86% of identity
• Blastx: BTB/POZ domain-containing protein At5g66560 from Arabidopsis with 62.86% of identity
• Eggnog: BTB POZ domain-containing protein(ENOG410YF5P)
• Kegg: Link to kegg annotations (AT5G66560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422041.1)
• Pfam: NPH3 family (PF03000.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;