Protein coding transcript 130094

• Transcript: Ll_transcript_70665
• CDS coordinates: 37-411 (+)
• Peptide sequence: MAKTKSEKKTRSAMTEVVTREFTINLHKRLHGIGFKKRAPRAIKEIRKFAEKQMGTPDVRIDTRLNKSLWSKGIRNVPFRVRVRLSRRRNDDEDSVNKLYTLVTYVPVATFKGLQTENVDANQE*
• ORF Type: complete

Annotations of Ll_transcript_70665

• Blastp: 60S ribosomal protein L31 from Paralichthys with 79.03% of identity
• Blastx: 60S ribosomal protein L31 from Spodoptera with 84.68% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001237204.1)
• Pfam: Ribosomal protein L31e (PF01198.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;