Protein coding transcript 130101

• Transcript: Ll_transcript_165834
• CDS coordinates: 2-556 (+)
• Peptide sequence: PHDEGSRSEVLERLDSDAQKLTNLQITIQDLMKKVEITETGKKGKSIEYNSAKDQLKATQETITKFLDANHELKKNVEDSSMPSGERGVVESGEIGSVSRRVTEYAQRGSEKIGQLQLEVQRLQFLFLKLNGGKESKGKAKVADHRSPRVLLRDYLYGGTRTNKQKKKKTPCLFACVRTLTKGD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_165834

• Blastp: Protein NETWORKED 1D from Arabidopsis with 44.2% of identity
• Blastx: Protein NETWORKED 1D from Arabidopsis with 44.2% of identity
• Eggnog: NA(ENOG410XW3C)
• Kegg: Link to kegg annotations (AT1G03080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441884.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;