Protein coding transcript 130106

• Transcript: Ll_transcript_165814
• CDS coordinates: 846-1241 (+)
• Peptide sequence: MAGTLTLKKSLLSLTSSRSVTQTINGSHKFMIEGYSMAKGMGVGKHIVSDLFTVGGYCWVIYFYPDGRNPKDNSAYVSVFIVLVSNSTNVRVLFELILVDQSGKGKHMVLSHFDRPLESVPHTLKCKGSMW*
• ORF Type: complete

Annotations of Ll_transcript_165814

• Blastp: BTB/POZ and MATH domain-containing protein 4 from Arabidopsis with 75.21% of identity
• Blastx: BTB/POZ and MATH domain-containing protein 4 from Arabidopsis with 68.8% of identity
• Eggnog: meprin and TRAF homology domain-containing protein MATH domain-containing protein(ENOG410XQV8)
• Kegg: Link to kegg annotations (AT3G03740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455876.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;