| Transcript | Ll_transcript_165817 |
|---|---|
| CDS coordinates | 3-332 (+) |
| Peptide sequence | GHSGVFRSLKRLATMFHWSGMRKNIEKFVLECTVCQHNKYQALKLAELLQPLPIPNHVWEDVSMDFIGGLPKAVGADTIMVVVDRLSKYAHFIPLQHPYTSKDVAQAFTK |
| ORF Type | internal |
| Blastp | Transposon Tf2-6 polyprotein from Schizosaccharomyces with 38.32% of identity |
|---|---|
| Blastx | Transposon Tf2-6 polyprotein from Schizosaccharomyces with 38.32% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (SPAC27E2.08) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_015964281.2) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer