Protein coding transcript 130108

• Transcript: Ll_transcript_262166
• CDS coordinates: 2120-2491 (-)
• Peptide sequence: MSLHLFHLPTQSWTDKNAESRTSKSESIYVPRDEEWEDIKHETVKQGKLKALLWNIAPMLLDNRTGTRGVLYIDHFIKDSDSKSELTGPNSLLNVGGAIADIFKFDPPKIFSSMCNQIVSDSS*
• ORF Type: complete

Annotations of Ll_transcript_262166

• Blastp: Putative lipoxygenase 5 from Oryza sativa with 50% of identity
• Blastx: Linoleate 13S-lipoxygenase 3-1, chloroplastic from Solanum with 54.83% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014633611.1)
• Pfam: Lipoxygenase (PF00305.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;