Protein coding transcript 130113

• Transcript: Ll_transcript_59012
• CDS coordinates: 1-339 (+)
• Peptide sequence: LLYQDFVDLNPNADMFHMGGDEVFIPCWNSTNEITDSLKDRSEKAFLDLWASFQQKALDKYDKVRNNHKTNLILWTSHLTNPAYIESYLPKDRYIIQTWVPQEDELPKELLKL
• ORF Type: internal

Annotations of Ll_transcript_59012

• Blastp: Chitooligosaccharidolytic beta-N-acetylglucosaminidase from Bombyx with 40.87% of identity
• Blastx: Chitooligosaccharidolytic beta-N-acetylglucosaminidase from Bombyx with 40.87% of identity
• Eggnog: ec 3.2.1.52(COG3525)
• Kegg: Link to kegg annotations (693032)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014512062.1)
• Pfam: Glycosyl hydrolase family 20, catalytic domain (PF00728.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;