Transcript | Ll_transcript_157008 |
---|---|
CDS coordinates | 35-352 (+) |
Peptide sequence | MEEHFTRIVQHVFNNWTALKLAVEHSMGGANSKQTAVECLNYMVQFCVYEQNVQVEDIQDALEDVLDQEFDMICEDDSPKEIAHILFKFLQILQQGTMEQLEEEYK |
ORF Type | 3prime_partial |
Blastp | Pre-rRNA-processing protein TSR2 homolog from Danio with 26.47% of identity |
---|---|
Blastx | Pre-rRNA-processing protein TSR2 homolog from Danio with 26.47% of identity |
Eggnog | TSR2, 20S rRNA accumulation, homolog (S. cerevisiae)(ENOG41123VE) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420802.1) |
Pfam | Pre-rRNA-processing protein TSR2 (PF10273.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer