Transcript | Ll_transcript_157012 |
---|---|
CDS coordinates | 2-301 (+) |
Peptide sequence | RILCAAYAQELPQYGIKVGLTNYAAAYCTGLLLARRLLSQLGLDKLYVGTTEVTGEEFNVEAVEDGPGAFRCYLDVGLMRTSTGARVFGAMKGAVDGGLN |
ORF Type | internal |
Blastp | 60S ribosomal protein L5 from Helianthus with 91% of identity |
---|---|
Blastx | 60S ribosomal protein L5 from Helianthus with 91% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003528810.1) |
Pfam | Ribosomal large subunit proteins 60S L5, and 50S L18 (PF17144.3) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer