Protein coding transcript 130116

• Transcript: Ll_transcript_157016
• CDS coordinates: 1-300 (+)
• Peptide sequence: QKVEIERLVTEMLEAGVIRTSISPYSSPVILMKKKDVGWRFCVDYRALNELTIPNKFPIPLIEELLDELGSARVFSKLDLKAGYHQIRMKAEDIEKTAFR
• ORF Type: internal

Annotations of Ll_transcript_157016

• Blastp: Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 51.04% of identity
• Blastx: Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 51.04% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YGR109W-B)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446853.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;