Protein coding transcript 130117

• Transcript: Ll_transcript_157011
• CDS coordinates: 2-787 (+)
• Peptide sequence: SKGLEFLRYDEKSIDMVFRTLPKCQVLIDRVLECTPTHDILHSDHNLAQAAMSNTLRESFQVYMTFSESIAALVNMYFDLTASAKGLACEILKKASMQSQKLHDLYESCKKIIENKNLEYPFVQIISMDHIIALDQFGSPQNQFAASHVSLPSRSSISKVPPISGHFKRSTKVELALAEKEGQKNEDKVDINFSPTLYSWTLETKISKVWVLFEDEAPKESQVFSAQQKLGDADVLNGIEIEYNRSSVFLNPFSSSIDTKV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_157011

• Blastp: Putative clathrin assembly protein At1g33340 from Arabidopsis with 42.53% of identity
• Blastx: Putative clathrin assembly protein At1g33340 from Arabidopsis with 42.53% of identity
• Eggnog: Clathrin assembly protein(ENOG410XQ90)
• Kegg: Link to kegg annotations (AT1G33340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418361.1)
• Pfam: ANTH domain (PF07651.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;