Protein coding transcript 130119

• Transcript: Ll_transcript_133695
• CDS coordinates: 139-621 (+)
• Peptide sequence: MADIEDTHFETGDSGASTTYPMQCSALRKNGFVMLKARPCKIVDMSTSKTGKHGHAKVHLVGLDIFSGKKYEDICPSTHNMDVPFVKREDYQLTDISDDGYLCLMSDNGDLREDLKIPDAEIGQQLKNEYDAGKELLCTVLKSCGEECVIAIKTNTALDK*
• ORF Type: complete

Annotations of Ll_transcript_133695

• Blastp: Eukaryotic translation initiation factor 5A from Spodoptera with 87.5% of identity
• Blastx: Eukaryotic translation initiation factor 5A from Spodoptera with 87.5% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451573.1)
• Pfam: Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold (PF01287.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;