Protein coding transcript 130123

• Transcript: Ll_transcript_16536
• CDS coordinates: 15-866 (-)
• Peptide sequence: EEIPQGQNLEFSNLETFVLANNQIKGSIPKWLSQCKKLQMLDLSWNHLSGTIPPWFGKFDNLYYLDLSNNSFTGNIPQSLAMLLTLQNMNFSLKGTVPGFPFYKKGGNVLKGLKYKRVSSFRPSLVISNNKLEGPIWPGFGNLKGLHVFDLKENSLSGPIPQQLSGMTMLETLDFSHNELSGEIPQSLVKLSFLSIFDVSYNQLQGKIPTGGQFDTFPPTSFEENKGLYLDEDSGSIPSQPEQNPGRPDHEKFELFNWPFGFGSIAGFLITIAICFTSGWVFS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_16536

• Blastp: Phytosulfokine receptor 1 from Daucus sect. Daucus with 56.14% of identity
• Blastx: Phytosulfokine receptor 1 from Daucus sect. Daucus with 56.14% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458999.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;