Protein coding transcript 130124

• Transcript: Ll_transcript_16530
• CDS coordinates: 201-671 (-)
• Peptide sequence: IKDIDYQAQKFVVYDPQFCLPNLLRTLSNSSISPFQYKSSYYDSELPKRNVSFFQCPSTYSSSCPIFQLESNGDFVDLEIVSCTKELDVLSVGWQVSYDDRNTFLMGWSKPNCTLCEAQGKKCRFKNNDTSAETECFICNTNKLATSAVVLISAGM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_16530

• Blastp: RING-H2 finger protein ATL20 from Arabidopsis with 31.76% of identity
• Blastx: RING-H2 finger protein ATL20 from Arabidopsis with 31.76% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT1G28040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419819.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;