Protein coding transcript 130125

• Transcript: Ll_transcript_16524
• CDS coordinates: 1-381 (+)
• Peptide sequence: RNLDINGFLEDLRNAPENAVIILHPCAHNPTGCDPTPDQWKQIAEVIRERRLFPFFDSAYQGFASGDLVKDAWAVRYFVEQGFEIFCSQSFAKNFGLYNERAGNLTIVMNDVMEIPKVKSQITLVVS
• ORF Type: internal

Annotations of Ll_transcript_16524

• Blastp: Aspartate aminotransferase, cytoplasmic from Sus with 67.46% of identity
• Blastx: Aspartate aminotransferase, cytoplasmic from Sus with 67.46% of identity
• Eggnog: aminotransferase(COG1448)
• Kegg: Link to kegg annotations (396967)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015945670.1)
• Pfam: Aminotransferase class I and II (PF00155.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;