Protein coding transcript 130126

• Transcript: Ll_transcript_16528
• CDS coordinates: 2-325 (+)
• Peptide sequence: KWRGVTCNTDQSRVIALRLPGVGLSGPLPNNTLSLPSALQILSLESNSITGPFPSGFTELKNLTRLYLQFNKFSGPLPLDFSVWNSLSVVNLSNNSFNGSIPSSISNL
• ORF Type: internal

Annotations of Ll_transcript_16528

• Blastp: Probable inactive receptor kinase At4g23740 from Arabidopsis with 67.29% of identity
• Blastx: Probable inactive receptor kinase At4g23740 from Arabidopsis with 67.29% of identity
• Eggnog: Leucine rich repeat N-terminal domain(ENOG410YDXU)
• Kegg: Link to kegg annotations (AT4G23740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417228.1)
• Pfam: Leucine Rich Repeat (PF00560.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;