Protein coding transcript 130131

• Transcript: Ll_transcript_243580
• CDS coordinates: 75-626 (+)
• Peptide sequence: MMMVNAKLALLLVSVAAFGYLQTALAYSEGAPLEVCTDLMPQHGAPAQTKESPYTLTLNRKSVKGGESMTLTLASKDFSKFKGFIIQARDSNDKPIGSFTSLPASKNNAEFKGKWKLISCPDGPTNNTATHANAVEKSRVVLTWNAPKNLEGQSLKFKYTVAKNGGEYWVGKESESVSVTKKN*
• ORF Type: complete

Annotations of Ll_transcript_243580

• Blastp: Putative ferric-chelate reductase 1 from Danio with 33.73% of identity
• Blastx: Putative defense protein Hdd11 from Hyphantria with 38.65% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (100038777)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014496587.1)
• Pfam: Reeler domain (PF02014.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;