Protein coding transcript 130135

• Transcript: Ll_transcript_243590
• CDS coordinates: 71-916 (+)
• Peptide sequence: MSEKKDEKVENVDKELSDLLDSALEDFTTTKDEPKKDSKEIGTTSNTENNVPEQWTEDFIQQAASQFEANFSNLLAGGDPNAQVTPEFIQQKLQQMAEAAQQVLENPAQVNETTTDFGQSISQAIQGLNQGAEGLQNPFSEDDLMKIFGNPEGGTNDLLPFMQGMMQGLLSKEVLGPSLKDFVARLPEYLEKNKDTISAEDKERYLNQKKLMEEVLQELDKEEESQNAEEKKETFSKVLALMQKLQDYGQPPSELVGDVETPFNFDPSGNPTAPPQDCSIM*
• ORF Type: complete

Annotations of Ll_transcript_243590

• Blastp: Peroxisomal biogenesis factor 19 from Rattus with 32.21% of identity
• Blastx: Peroxisomal biogenesis factor 19 from Rattus with 34.31% of identity
• Eggnog: peroxisomal biogenesis factor 19(ENOG4111QGU)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015933903.1)
• Pfam: Pex19 protein family (PF04614.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;